Lineage for d1ml5s_ (1ml5 S:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526548Domain d1ml5s_: 1ml5 S: [79274]

Details for d1ml5s_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5s_:

Sequence, based on SEQRES records: (download)

>d1ml5s_ i.1.1.1 (S:) 70S ribosome functional complex {Escherichia coli}
mvkirlarfgskhnphyphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverar
ywlsvgaqptdtarrllrqagvfrqe

Sequence, based on observed residues (ATOM records): (download)

>d1ml5s_ i.1.1.1 (S:) 70S ribosome functional complex {Escherichia coli}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1ml5s_:

Click to download the PDB-style file with coordinates for d1ml5s_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5s_: