Lineage for d1ml5f_ (1ml5 F:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526535Domain d1ml5f_: 1ml5 F: [79261]

Details for d1ml5f_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5f_ i.1.1.1 (F:) 70S ribosome functional complex {Escherichia coli}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1ml5f_:

Click to download the PDB-style file with coordinates for d1ml5f_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5f_: