![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
![]() | Family b.26.1.1: SMAD domain [49880] (5 proteins) |
![]() | Protein Smad3 MH2 domain [82030] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82031] (4 PDB entries) Uniprot P84022 228-425 |
![]() | Domain d1mk2a_: 1mk2 A: [79217] Other proteins in same PDB: d1mk2b_ complexed with acy |
PDB Entry: 1mk2 (more details), 2.74 Å
SCOPe Domain Sequences for d1mk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk2a_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens) [TaxId: 9606]} dlqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnr naaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcn lkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielh lngplqwldkvltqmgs
Timeline for d1mk2a_: