Lineage for d1mk2a_ (1mk2 A:)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
sandwich; 11 strands in 2 sheets; greek-keySuperfamily b.26.1: SMAD/FHA domain [49879] (2 families) 
has a few short helices inserted in loops
Family b.26.1.1: SMAD domain [49880] (4 proteins) Protein Smad3 MH2 domain [82030] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82031] (2 PDB entries) 
Domain d1mk2a_: 1mk2 A: [79217]
Other proteins in same PDB: d1mk2b_
complexed with acy
Details for d1mk2a_
PDB Entry: 1mk2 (more details), 2.74 Å
PDB Description: SMAD3 SBD complex
SCOP Domain Sequences for d1mk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk2a_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens)}
dlqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnr
naaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcn
lkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielh
lngplqwldkvltqmgs
SCOP Domain Coordinates for d1mk2a_:
Click to download the PDB-style file with coordinates for d1mk2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mk2a_:
- d1mk2a_ is new in SCOP 1.63
- d1mk2a_ appears in SCOP 1.65
- d1mk2a_ appears in the current release, SCOPe 2.08
View in 3D
