PDB entry 1mk2

View 1mk2 on RCSB PDB site
Description: SMAD3 SBD complex
Class: transcription
Keywords: smad3, sbd, sara, transcription
Deposited on 2002-08-28, released 2002-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: smad 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mk2a_
  • Chain 'B':
    Compound: Madh-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mk2b_
  • Heterogens: ACY

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mk2A (A:)
    dlqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnr
    naaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcn
    lkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielh
    lngplqwldkvltqmgspsircssvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mk2A (A:)
    dlqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnr
    naaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcn
    lkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielh
    lngplqwldkvltqmgs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mk2B (B:)
    spnpnnpaeycstipplqqaqasgalssppptvmvpvg