Lineage for d1mg3d_ (1mg3 D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209924Protein Cytochrome c551 [46660] (4 species)
  7. 209927Species Paracoccus denitrificans [TaxId:266] [46663] (3 PDB entries)
  8. 209933Domain d1mg3d_: 1mg3 D: [79078]
    Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3c_, d1mg3e_, d1mg3f_, d1mg3g_, d1mg3i_, d1mg3j_, d1mg3k_, d1mg3m_, d1mg3n_, d1mg3o_

Details for d1mg3d_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin

SCOP Domain Sequences for d1mg3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3d_ a.3.1.1 (D:) Cytochrome c551 {Paracoccus denitrificans}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d1mg3d_:

Click to download the PDB-style file with coordinates for d1mg3d_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3d_: