Lineage for d1mg3i_ (1mg3 I:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233372Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 233382Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) (S)
  5. 233383Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
  6. 233384Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 233389Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)
  8. 233399Domain d1mg3i_: 1mg3 I: [79083]
    Other proteins in same PDB: d1mg3b_, d1mg3c_, d1mg3d_, d1mg3f_, d1mg3g_, d1mg3h_, d1mg3j_, d1mg3k_, d1mg3l_, d1mg3n_, d1mg3o_, d1mg3p_

Details for d1mg3i_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin

SCOP Domain Sequences for d1mg3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3i_ b.69.2.1 (I:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOP Domain Coordinates for d1mg3i_:

Click to download the PDB-style file with coordinates for d1mg3i_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3i_: