PDB entry 1mg3

View 1mg3 on RCSB PDB site
Description:
Deposited on 2002-08-14, released 2002-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3e_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3f_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3g_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3h_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3i_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3j_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3k_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3l_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3m_
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3n_
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3o_
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mg3p_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3A (A:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3B (B:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3C (C:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3D (D:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3E (E:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3F (F:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3G (G:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3H (H:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3I (I:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3J (J:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3K (K:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3L (L:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3M (M:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3N (N:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3O (O:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg3P (P:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp