Lineage for d1mc8b2 (1mc8 B:2-220)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011866Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1011867Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 1011923Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1011929Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)
  7. 1011944Species Pyrococcus horikoshii [TaxId:53953] [82436] (1 PDB entry)
  8. 1011946Domain d1mc8b2: 1mc8 B:2-220 [78948]
    Other proteins in same PDB: d1mc8a1, d1mc8b1
    mutant

Details for d1mc8b2

PDB Entry: 1mc8 (more details), 3.1 Å

PDB Description: crystal structure of flap endonuclease-1 r42e mutant from pyrococcus horikoshii
PDB Compounds: (B:) Flap Endonuclease-1

SCOPe Domain Sequences for d1mc8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc8b2 c.120.1.2 (B:2-220) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus horikoshii [TaxId: 53953]}
gvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsgl
fyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearkya
qratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfga
prlirnltitgkrkmpgkdvyveikpelvvldevlkelk

SCOPe Domain Coordinates for d1mc8b2:

Click to download the PDB-style file with coordinates for d1mc8b2.
(The format of our PDB-style files is described here.)

Timeline for d1mc8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mc8b1