| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [81798] (1 PDB entry) |
| Domain d1mc8b1: 1mc8 B:221-332 [78947] Other proteins in same PDB: d1mc8a2, d1mc8b2 mutant |
PDB Entry: 1mc8 (more details), 3.1 Å
SCOPe Domain Sequences for d1mc8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc8b1 a.60.7.1 (B:221-332) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus horikoshii [TaxId: 53953]}
itreklielailvgtdynpggvkgigpkkaleivrysrdplakfqrqsdvdlyaikeffl
nppvtneyslswkepdeegilkflcdehnfseervkngierlkkaikagrqs
Timeline for d1mc8b1: