SCOP 1.63: Domain d1mc8b2: 1mc8 B:2-220

Lineage for d1mc8b2 (1mc8 B:2-220)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)

5. Family c.53.1.2: 5' to 3' exonuclease [53045] (4 proteins)
   contains additional strand and alpha-helical arch; strand order 321456; strand 6 is antiparallel to the rest

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (3 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [82436] (1 PDB entry)

8. Domain d1mc8b2: 1mc8 B:2-220 [78948]
   Other proteins in same PDB: d1mc8a1, d1mc8b1
   mutant

Details for d1mc8b2

PDB Entry: 1mc8, 3.1 Å

PDB Description: crystal structure of flap endonuclease-1 r42e mutant from pyrococcus horikoshii

SCOP Domain Sequences for d1mc8b2:

Sequence; same for both SEQRES and ATOM records:

>d1mc8b2 c.53.1.2 (B:2-220) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus horikoshii}
gvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsgl
fyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearkya
qratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfga
prlirnltitgkrkmpgkdvyveikpelvvldevlkelk

Timeline for d1mc8b2:

• d1mc8b2 is new in SCOP 1.63
  
• d1mc8b2 appears in SCOP 1.65
  
• d1mc8b2 appears in the current release, SCOPe 2.08