SCOP 1.63: Domain d1mc1b2: 1mc1 B:3-209

Lineage for d1mc1b2 (1mc1 B:3-209)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins)
   has slightly different topology than other families do

6. Protein beta-Lactam synthetase [69831] (1 species)
   Asparagine synthetase B homologue

7. Species Streptomyces clavuligerus [TaxId:1901] [69832] (5 PDB entries)

8. Domain d1mc1b2: 1mc1 B:3-209 [78942]
   Other proteins in same PDB: d1mc1a1, d1mc1b1
   complexed with amp, mg, pcx, pop

Details for d1mc1b2

PDB Entry: 1mc1, 2.16 Å

PDB Description: beta-lactam synthetase with product (dgpc), amp and ppi

SCOP Domain Sequences for d1mc1b2:

Sequence; same for both SEQRES and ATOM records:

>d1mc1b2 d.153.1.1 (B:3-209) beta-Lactam synthetase {Streptomyces clavuligerus}
apvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdrav
arsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfa
tvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvaglt
gvyqvpagavmdidlgsgtavthrtwt

Timeline for d1mc1b2:

• d1mc1b2 is new in SCOP 1.63
  
• d1mc1b2 appears in SCOP 1.65
  
• d1mc1b2 appears in the current release, SCOPe 2.08