![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
![]() | Protein beta-Lactam synthetase [69831] (2 species) Asparagine synthetase B homologue |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [69832] (5 PDB entries) |
![]() | Domain d1mc1b2: 1mc1 B:3-209 [78942] Other proteins in same PDB: d1mc1a1, d1mc1b1 complexed with amp, mg, pcx, pop |
PDB Entry: 1mc1 (more details), 2.16 Å
SCOPe Domain Sequences for d1mc1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc1b2 d.153.1.1 (B:3-209) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} apvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdrav arsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfa tvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvaglt gvyqvpagavmdidlgsgtavthrtwt
Timeline for d1mc1b2: