![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47532] (5 PDB entries) |
![]() | Domain d1m63f_: 1m63 F: [78681] Other proteins in same PDB: d1m63a_, d1m63c_, d1m63e_, d1m63g_ complexed with ca, fe, zn |
PDB Entry: 1m63 (more details), 2.8 Å
SCOPe Domain Sequences for d1m63f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m63f_ a.39.1.5 (F:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} mcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngev dfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlq qivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
Timeline for d1m63f_: