Lineage for d1m63b_ (1m63 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087980Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1087985Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species)
  7. 1087988Species Human (Homo sapiens) [TaxId:9606] [47532] (5 PDB entries)
  8. 1087993Domain d1m63b_: 1m63 B: [78678]
    Other proteins in same PDB: d1m63a_, d1m63c_, d1m63e_, d1m63g_
    complexed with ca, fe, zn

Details for d1m63b_

PDB Entry: 1m63 (more details), 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
PDB Compounds: (B:) calcineurin b subunit isoform 1

SCOPe Domain Sequences for d1m63b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m63b_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
shfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdf
kefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqi
vdktiinadkdgdgrisfeefcavvggldihkkmvvdv

SCOPe Domain Coordinates for d1m63b_:

Click to download the PDB-style file with coordinates for d1m63b_.
(The format of our PDB-style files is described here.)

Timeline for d1m63b_: