Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) |
Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins) |
Protein Sec24 [81999] (1 species) includes the N-terminal tail |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries) |
Domain d1m2vb2: 1m2v B:61-215,B:553-646 [78498] Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb3, d1m2vb4, d1m2vb5 complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m2v (more details), 2.75 Å
SCOPe Domain Sequences for d1m2vb2:
Sequence, based on SEQRES records: (download)
>d1m2vb2 b.2.8.1 (B:61-215,B:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fltpaqeqlhqqidqattsmndmhlhnvplvdpnaymqpqvpvqmgtplqqqqqpmaapa ygqpsaamgqnmrpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspd yirstlnavpknssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghff nrssdlcafstmprdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptt eslaevyasa
>d1m2vb2 b.2.8.1 (B:61-215,B:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fltpaqeqlhqqirpmnqlypidlltelpppitdltlpppplvippermlvpselsnasp dyirstlnavpknssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghf fnrssdlcafstmprdqsylfevnvdesimadycyvqvavllslnnsqrririitlampt teslaevyasa
Timeline for d1m2vb2: