Lineage for d1m2vb2 (1m2v B:61-215,B:553-646)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034721Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) (S)
  5. 2034722Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 protein domains)
  6. 2034729Protein Sec24 [81999] (1 species)
    includes the N-terminal tail
  7. 2034730Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries)
  8. 2034734Domain d1m2vb2: 1m2v B:61-215,B:553-646 [78498]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb3, d1m2vb4, d1m2vb5
    complexed with zn

Details for d1m2vb2

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer
PDB Compounds: (B:) protein transport protein SEC24

SCOPe Domain Sequences for d1m2vb2:

Sequence, based on SEQRES records: (download)

>d1m2vb2 b.2.8.1 (B:61-215,B:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fltpaqeqlhqqidqattsmndmhlhnvplvdpnaymqpqvpvqmgtplqqqqqpmaapa
ygqpsaamgqnmrpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspd
yirstlnavpknssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghff
nrssdlcafstmprdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptt
eslaevyasa

Sequence, based on observed residues (ATOM records): (download)

>d1m2vb2 b.2.8.1 (B:61-215,B:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fltpaqeqlhqqirpmnqlypidlltelpppitdltlpppplvippermlvpselsnasp
dyirstlnavpknssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghf
fnrssdlcafstmprdqsylfevnvdesimadycyvqvavllslnnsqrririitlampt
teslaevyasa

SCOPe Domain Coordinates for d1m2vb2:

Click to download the PDB-style file with coordinates for d1m2vb2.
(The format of our PDB-style files is described here.)

Timeline for d1m2vb2: