| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) ![]() automatically mapped to Pfam PF04815 |
| Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins) |
| Protein Sec24 [81815] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (4 PDB entries) |
| Domain d1m2vb1: 1m2v B:647-753 [78497] Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5 complexed with zn |
PDB Entry: 1m2v (more details), 2.75 Å
SCOPe Domain Sequences for d1m2vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2vb1 a.71.2.1 (B:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan
lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy
Timeline for d1m2vb1: