Lineage for d1m2vb3 (1m2v B:301-552)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2129081Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 protein domains)
    automatically mapped to Pfam PF04811
  6. 2129088Protein Sec24 [82461] (1 species)
  7. 2129089Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82462] (4 PDB entries)
  8. 2129093Domain d1m2vb3: 1m2v B:301-552 [78499]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb2, d1m2vb4, d1m2vb5
    complexed with zn

Details for d1m2vb3

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer
PDB Compounds: (B:) protein transport protein SEC24

SCOPe Domain Sequences for d1m2vb3:

Sequence, based on SEQRES records: (download)

>d1m2vb3 c.62.1.2 (B:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlit
nfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqllscqd
sfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkf
stefakhismdf

Sequence, based on observed residues (ATOM records): (download)

>d1m2vb3 c.62.1.2 (B:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlitnfalgpalk
sayhliggvggkiivvsgtlpnlgigklqrrnentsketaqllscqdsfyknftidcskv
qitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkfstefakhismdf

SCOPe Domain Coordinates for d1m2vb3:

Click to download the PDB-style file with coordinates for d1m2vb3.
(The format of our PDB-style files is described here.)

Timeline for d1m2vb3: