PDB entry 1m2v

View 1m2v on RCSB PDB site
Description: Crystal Structure of the yeast Sec23/24 heterodimer
Class: protein transport
Keywords: zinc-finger, beta barrel, vWA domain, gelsolin domain,, PROTEIN TRANSPORT
Deposited on 2002-06-25, released 2002-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein transport protein SEC23
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Sec23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5
  • Chain 'B':
    Compound: protein transport protein SEC24
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Sar1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m2vA (A:)
    mdfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydelnvapynpvvcsgph
    cksilnpycvidprnsswscpicnsrnhlppqytnlsqenmplelqsttieyitnkpvtv
    ppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrcn
    vfrgdreyqlealtemltgqkptgpggaashlpnamnkvtpfslnrfflpleqvefklnq
    llenlspdqwsvpaghrplratgsalniaslllqgcyknipariilfasgpgtvapgliv
    nselkdplrshhdidsdhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemkq
    ltdstggvllltdafstaifkqsylrlfakdeegylkmafngnmavktskdlkvqgligh
    asavkktdanniseseigigatstwkmaslspyhsyaiffeiantaansnpmmsapgsad
    rphlaytqfittyqhssgtnrirvttvanqllpfgtpaiaasfdqeaaavlmariavhka
    etddgadvirwldrtliklcqkyadynkddpqsfrlapnfslypqftyylrrsqflsvfn
    nspdetafyrhiftredttnslimiqptltsfsmeddpqpvlldsisvkpntillldtff
    filiyhgeqiaqwrkagyqddpqyadfkalleepkleaaellvdrfplprfidteaggsq
    arfllsklnpsdnyqdmarggstivltddvslqnfmthlqqvavsgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m2vA (A:)
    dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydelnvapynpvvcsgphc
    ksilnpycvidprnsswscpicnsrnhlppqytnlsqenmplelqsttieyitnkpvtvp
    pifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrcnv
    frgdreyqlealtemltpfslnrfflpleqvefklnqllenlspdqwsvpaghrplratg
    salniaslllqgcyknipariilfasgpgtvapglivnselkdplrshhdidsdhaqhyk
    kackfynqiaqrvaanghtvdifagcydqigmsemkqltdstggvllltdafstaifkqs
    ylrlfakdeegylkmafngnmavktskdlkvqglighasavkktdanniseseigigats
    twkmaslspyhsyaiffeiantrphlaytqfittyqhssgtnrirvttvanqllpfgtpa
    iaasfdqeaaavlmariavhkaetdvirwldrtliklcqkyadynkddpqsfrlapnfsl
    ypqftyylrrsqflsvfnnspdetafyrhiftredttnslimiqptltsfsmeddpqpvl
    ldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyadfkalleepkleaaell
    vdrfplprfidteaggsqarfllsklvslqnfmthlqqvavsgqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m2vB (B:)
    mshhkkrvypqaqlqygqnatplqqpaqfmppqdpaaagmsygqmgmppqgavpsmgqqq
    fltpaqeqlhqqidqattsmndmhlhnvplvdpnaymqpqvpvqmgtplqqqqqpmaapa
    ygqpsaamgqnmrpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspd
    yirstlnavpknssllkksklpfglvirpyqhlyddidppplnedglivrcrrcrsymnp
    fvtfieqgrrwrcnfcrlandvpmqmdqsdpndpksrydrneikcavmeymapkeytlrq
    pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
    ldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlit
    nfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqllscqd
    sfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkf
    stefakhismdfcmetvmrargstglrmsrfyghffnrssdlcafstmprdqsylfevnv
    desimadycyvqvavllslnnsqrririitlamptteslaevyasadqlaiasfynskav
    ekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcanlrmfpllmhsltkh
    mafrsgivpsdhrasalnnleslplkylikniypdvyslhdmadeaglpvqtedgeatgt
    ivlpqpinatsslferyglylidngnelflwmggdavpalvfdvfgtqdifdipigkqei
    pvvensefnqrvrniinqlrnhddvityqslyivrgaslsepvnhasarevatlrlwass
    tlvedkilnnesyreflqimkarisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m2vB (B:)
    fltpaqeqlhqqirpmnqlypidlltelpppitdltlpppplvippermlvpselsnasp
    dyirstlnavpknssllkksklpfglvirpyqhlyddidppplnedglivrcrrcrsymn
    pfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpksrydrneikcavmeymapkeytlr
    qpppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfki
    pldqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlitnfalgpal
    ksayhliggvggkiivvsgtlpnlgigklqrrnentsketaqllscqdsfyknftidcsk
    vqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkfstefakhismdf
    cmetvmrargstglrmsrfyghffnrssdlcafstmprdqsylfevnvdesimadycyvq
    vavllslnnsqrririitlamptteslaevyasadqlaiasfynskavekalnsslddar
    vlinksvqdilatykkeivvsntaggaplrlcanlrmfpllmhsltkhmafrsgivpsdh
    rasalnnleslplkylikniypdvyslhdmadeaglpgtivlpqpinatsslferyglyl
    idngnelflwmggdavpalvffnqrvrniinqlrnhddvityqslyivrarevatlrlwa
    sstlvedkilnnesyreflqimkarisk