Lineage for d1m18c_ (1m18 C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353078Protein Histone H2A [47115] (4 species)
  7. 353079Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (19 PDB entries)
  8. 353088Domain d1m18c_: 1m18 C: [78373]
    Other proteins in same PDB: d1m18a_, d1m18b_, d1m18d_, d1m18e_, d1m18f_, d1m18h_

Details for d1m18c_

PDB Entry: 1m18 (more details), 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m18c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m18c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis)}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

SCOP Domain Coordinates for d1m18c_:

Click to download the PDB-style file with coordinates for d1m18c_.
(The format of our PDB-style files is described here.)

Timeline for d1m18c_: