SCOP 1.69: Domain d1m18c_: 1m18 C:

Lineage for d1m18c_ (1m18 C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (19 PDB entries)

8. Domain d1m18c_: 1m18 C: [78373]
   Other proteins in same PDB: d1m18a_, d1m18b_, d1m18d_, d1m18e_, d1m18f_, d1m18h_

Details for d1m18c_

PDB Entry: 1m18, 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m18c_:

Sequence; same for both SEQRES and ATOM records:

>d1m18c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis)}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

Timeline for d1m18c_:

• d1m18c_ first appeared in SCOP 1.63
  
• d1m18c_ appears in SCOP 1.67
  
• d1m18c_ appears in SCOP 1.71
  
• d1m18c_ appears in the current release, SCOPe 2.08