Lineage for d1m18d_ (1m18 D:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353131Protein Histone H2B [47119] (3 species)
  7. 353132Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)
  8. 353141Domain d1m18d_: 1m18 D: [78374]
    Other proteins in same PDB: d1m18a_, d1m18b_, d1m18c_, d1m18e_, d1m18f_, d1m18g_

Details for d1m18d_

PDB Entry: 1m18 (more details), 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m18d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m18d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1m18d_:

Click to download the PDB-style file with coordinates for d1m18d_.
(The format of our PDB-style files is described here.)

Timeline for d1m18d_: