SCOP 1.67: Domain d1m18d_: 1m18 D:

Lineage for d1m18d_ (1m18 D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)

8. Domain d1m18d_: 1m18 D: [78374]
   Other proteins in same PDB: d1m18a_, d1m18b_, d1m18c_, d1m18e_, d1m18f_, d1m18g_

Details for d1m18d_

PDB Entry: 1m18, 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m18d_:

Sequence; same for both SEQRES and ATOM records:

>d1m18d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1m18d_:

• d1m18d_ first appeared in SCOP 1.63
  
• d1m18d_ appears in SCOP 1.65
  
• d1m18d_ appears in SCOP 1.69
  
• d1m18d_ appears in the current release, SCOPe 2.08