SCOP 1.63: Domain d1lqmb_: 1lqm B:

Lineage for d1lqmb_ (1lqm B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (8 PDB entries)

8. Domain d1lqmb_: 1lqm B: [78142]
   Other proteins in same PDB: d1lqma_, d1lqmc_, d1lqme_, d1lqmg_

Details for d1lqmb_

PDB Entry: 1lqm, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1lqmb_:

Sequence; same for both SEQRES and ATOM records:

>d1lqmb_ d.17.5.1 (B:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

Timeline for d1lqmb_:

• d1lqmb_ is new in SCOP 1.63
  
• d1lqmb_ appears in SCOP 1.65
  
• d1lqmb_ appears in the current release, SCOPe 2.08