PDB entry 1lqm

View 1lqm on RCSB PDB site
Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Deposited on 2002-05-10, released 2002-11-10
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-22, with a file datestamp of 2002-11-22.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.188
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lqma_
  • Chain 'B':
    Domains in SCOP 1.63: d1lqmb_
  • Chain 'C':
    Domains in SCOP 1.63: d1lqmc_
  • Chain 'D':
    Domains in SCOP 1.63: d1lqmd_
  • Chain 'E':
    Domains in SCOP 1.63: d1lqme_
  • Chain 'F':
    Domains in SCOP 1.63: d1lqmf_
  • Chain 'G':
    Domains in SCOP 1.63: d1lqmg_
  • Chain 'H':
    Domains in SCOP 1.63: d1lqmh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmA (A:)
    eltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgq
    dpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvllln
    tvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvl
    kaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmB (B:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmC (C:)
    eltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgq
    dpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvllln
    tvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvl
    kaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmD (D:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmE (E:)
    eltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgq
    dpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvllln
    tvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvl
    kaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmF (F:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmG (G:)
    aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqmH (H:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml