SCOP 1.65: Domain d1lg1a2: 1lg1 A:267-334

Lineage for d1lg1a2 (1lg1 A:267-334)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitotriosidase [82628] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82629] (4 PDB entries)

8. Domain d1lg1a2: 1lg1 A:267-334 [77949]
   Other proteins in same PDB: d1lg1a1
   complexed with nag

Details for d1lg1a2

PDB Entry: 1lg1, 2.78 Å

PDB Description: crystal structure of human chitotriosidase in complex with chitobiose

SCOP Domain Sequences for d1lg1a2:

Sequence; same for both SEQRES and ATOM records:

>d1lg1a2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens)}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

Timeline for d1lg1a2:

• d1lg1a2 first appeared in SCOP 1.63
  
• d1lg1a2 appears in SCOP 1.67
  
• d1lg1a2 appears in the current release, SCOPe 2.08