![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitotriosidase [82628] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82629] (11 PDB entries) |
![]() | Domain d1lg1a2: 1lg1 A:267-334 [77949] Other proteins in same PDB: d1lg1a1 |
PDB Entry: 1lg1 (more details), 2.78 Å
SCOPe Domain Sequences for d1lg1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lg1a2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif rdnqwvgf
Timeline for d1lg1a2: