Lineage for d1lg1a2 (1lg1 A:267-334)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255830Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 255831Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins)
  6. 255880Protein Chitotriosidase [82628] (1 species)
  7. 255881Species Human (Homo sapiens) [TaxId:9606] [82629] (2 PDB entries)
  8. 255883Domain d1lg1a2: 1lg1 A:267-334 [77949]
    Other proteins in same PDB: d1lg1a1
    complexed with nag

Details for d1lg1a2

PDB Entry: 1lg1 (more details), 2.78 Å

PDB Description: crystal structure of human chitotriosidase in complex with chitobiose

SCOP Domain Sequences for d1lg1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lg1a2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens)}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

SCOP Domain Coordinates for d1lg1a2:

Click to download the PDB-style file with coordinates for d1lg1a2.
(The format of our PDB-style files is described here.)

Timeline for d1lg1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lg1a1