PDB entry 1lg1

View 1lg1 on RCSB PDB site
Description: crystal structure of human chitotriosidase in complex with chitobiose
Deposited on 2002-04-14, released 2002-09-18
The last revision prior to the SCOP 1.65 freeze date was dated 2002-09-18, with a file datestamp of 2002-09-18.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lg1A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqels