Lineage for d1la0a_ (1la0 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213494Protein Troponin C [47503] (5 species)
  7. 213495Species Chicken (Gallus gallus) [TaxId:9031] [47504] (23 PDB entries)
  8. 213512Domain d1la0a_: 1la0 A: [77864]
    calcium saturated troponin C bound to troponin I
    complexed with ca

Details for d1la0a_

PDB Entry: 1la0 (more details)

PDB Description: Solution Structure of Calcium Saturated Cardiac Troponin C in the Troponin C-Troponin I Complex

SCOP Domain Sequences for d1la0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1la0a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkddskgkteeelsdlfrmfdknadgyidleelkim
lqatgetiteddieelmkdgdknndgridydeflefmkgve

SCOP Domain Coordinates for d1la0a_:

Click to download the PDB-style file with coordinates for d1la0a_.
(The format of our PDB-style files is described here.)

Timeline for d1la0a_: