| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (3 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (8 PDB entries) |
| Domain d1kx5e_: 1kx5 E: [77597] Other proteins in same PDB: d1kx5b_, d1kx5c_, d1kx5d_, d1kx5f_, d1kx5g_, d1kx5h_ complexed with cl, mn |
PDB Entry: 1kx5 (more details), 1.94 Å
SCOP Domain Sequences for d1kx5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx5e_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)}
artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera
Timeline for d1kx5e_: