| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (4 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (7 PDB entries) |
| Domain d1kx5c_: 1kx5 C: [77595] Other proteins in same PDB: d1kx5a_, d1kx5b_, d1kx5d_, d1kx5e_, d1kx5f_, d1kx5h_ |
PDB Entry: 1kx5 (more details), 1.94 Å
SCOP Domain Sequences for d1kx5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx5c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis)}
sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
essksksk
Timeline for d1kx5c_: