PDB entry 1kx5

View 1kx5 on RCSB PDB site
Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
Deposited on 2002-01-31, released 2002-12-25
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-25, with a file datestamp of 2002-12-25.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.208
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1kx5a_
  • Chain 'B':
    Domains in SCOP 1.63: d1kx5b_
  • Chain 'C':
    Domains in SCOP 1.63: d1kx5c_
  • Chain 'D':
    Domains in SCOP 1.63: d1kx5d_
  • Chain 'E':
    Domains in SCOP 1.63: d1kx5e_
  • Chain 'F':
    Domains in SCOP 1.63: d1kx5f_
  • Chain 'G':
    Domains in SCOP 1.63: d1kx5g_
  • Chain 'H':
    Domains in SCOP 1.63: d1kx5h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5A (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5B (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5C (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5D (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5E (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5F (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5G (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5H (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak