SCOP 1.73: Domain d1kx4c_: 1kx4 C:

Lineage for d1kx4c_ (1kx4 C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (20 PDB entries)

8. Domain d1kx4c_: 1kx4 C: [77587]
   Other proteins in same PDB: d1kx4a_, d1kx4b_, d1kx4d_, d1kx4e_, d1kx4f_, d1kx4h_

Details for d1kx4c_

PDB Entry: 1kx4, 2.6 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution

PDB Compounds: (C:) histone h2a.1

SCOP Domain Sequences for d1kx4c_:

Sequence; same for both SEQRES and ATOM records:

>d1kx4c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

Timeline for d1kx4c_:

• d1kx4c_ first appeared in SCOP 1.63
  
• d1kx4c_ appears in SCOP 1.71
  
• d1kx4c_ appears in SCOP 1.75
  
• d1kx4c_ appears in the current release, SCOPe 2.08