Lineage for d1kx4b_ (1kx4 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637645Protein Histone H4 [47125] (4 species)
  7. 637646Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (28 PDB entries)
  8. 637676Domain d1kx4b_: 1kx4 B: [77586]
    Other proteins in same PDB: d1kx4a_, d1kx4c_, d1kx4d_, d1kx4e_, d1kx4g_, d1kx4h_

Details for d1kx4b_

PDB Entry: 1kx4 (more details), 2.6 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution
PDB Compounds: (B:) histone h4

SCOP Domain Sequences for d1kx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx4b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1kx4b_:

Click to download the PDB-style file with coordinates for d1kx4b_.
(The format of our PDB-style files is described here.)

Timeline for d1kx4b_: