Lineage for d1kx3h_ (1kx3 H:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637507Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)
  8. 637513Domain d1kx3h_: 1kx3 H: [77584]
    Other proteins in same PDB: d1kx3a_, d1kx3b_, d1kx3c_, d1kx3e_, d1kx3f_, d1kx3g_
    complexed with mn

Details for d1kx3h_

PDB Entry: 1kx3 (more details), 2 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
PDB Compounds: (H:) histone h2b.2

SCOP Domain Sequences for d1kx3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx3h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1kx3h_:

Click to download the PDB-style file with coordinates for d1kx3h_.
(The format of our PDB-style files is described here.)

Timeline for d1kx3h_: