SCOP 1.73: Domain d1kx3a_: 1kx3 A:

Lineage for d1kx3a_ (1kx3 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (23 PDB entries)

8. Domain d1kx3a_: 1kx3 A: [77577]
   Other proteins in same PDB: d1kx3b_, d1kx3c_, d1kx3d_, d1kx3f_, d1kx3g_, d1kx3h_

Details for d1kx3a_

PDB Entry: 1kx3, 2 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution

PDB Compounds: (A:) histone h3

SCOP Domain Sequences for d1kx3a_:

Sequence; same for both SEQRES and ATOM records:

>d1kx3a_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d1kx3a_:

• d1kx3a_ first appeared in SCOP 1.63
  
• d1kx3a_ appears in SCOP 1.71
  
• d1kx3a_ appears in SCOP 1.75
  
• d1kx3a_ appears in the current release, SCOPe 2.08