Lineage for d1kr6a_ (1kr6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570210Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2570226Protein Thermolysin [63414] (3 species)
  7. 2570227Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
    Uniprot P00800
  8. 2570291Domain d1kr6a_: 1kr6 A: [77512]
    complexed with ca, dgl, phq, zn

Details for d1kr6a_

PDB Entry: 1kr6 (more details), 1.8 Å

PDB Description: Thermolysin complexed with Z-D-Glutamic acid (benzyloxycarbonyl-D-Glutamic acid)
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d1kr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr6a_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d1kr6a_:

Click to download the PDB-style file with coordinates for d1kr6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr6a_: