Lineage for d1kr6a_ (1kr6 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 259931Family d.92.1.2: Thermolysin-like [55490] (4 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 259942Protein Thermolysin [63414] (1 species)
  7. 259943Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (51 PDB entries)
  8. 259962Domain d1kr6a_: 1kr6 A: [77512]
    complexed with ca, dgl, phq, zn

Details for d1kr6a_

PDB Entry: 1kr6 (more details), 1.8 Å

PDB Description: Thermolysin complexed with Z-D-Glutamic acid (benzyloxycarbonyl-D-Glutamic acid)

SCOP Domain Sequences for d1kr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr6a_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOP Domain Coordinates for d1kr6a_:

Click to download the PDB-style file with coordinates for d1kr6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr6a_: