Lineage for d1kfah2 (1kfa H:127-227)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220941Species Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain [81952] (1 PDB entry)
  8. 220942Domain d1kfah2: 1kfa H:127-227 [77362]
    Other proteins in same PDB: d1kfah1, d1kfai1, d1kfal1, d1kfam1

Details for d1kfah2

PDB Entry: 1kfa (more details), 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

SCOP Domain Sequences for d1kfah2:

Sequence, based on SEQRES records: (download)

>d1kfah2 b.1.1.2 (H:127-227) Immunoglobulin (constant domains of L and H chains) {Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain}
akttppsvyplapxxxxxxxsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsssrpsetvtcnvahpasstkvdkkivpad

Sequence, based on observed residues (ATOM records): (download)

>d1kfah2 b.1.1.2 (H:127-227) Immunoglobulin (constant domains of L and H chains) {Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsssrpsetvtcnvahpasstkvdkkivpad

SCOP Domain Coordinates for d1kfah2:

Click to download the PDB-style file with coordinates for d1kfah2.
(The format of our PDB-style files is described here.)

Timeline for d1kfah2: