Lineage for d1kfal1 (1kfa L:1-112)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219042Species Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain [81946] (1 PDB entry)
  8. 219045Domain d1kfal1: 1kfa L:1-112 [77365]
    Other proteins in same PDB: d1kfah2, d1kfai2, d1kfal2, d1kfam2

Details for d1kfal1

PDB Entry: 1kfa (more details), 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4
PDB Compounds: (L:)

SCOP Domain Sequences for d1kfal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfal1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain}
dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleik

SCOP Domain Coordinates for d1kfal1:

Click to download the PDB-style file with coordinates for d1kfal1.
(The format of our PDB-style files is described here.)

Timeline for d1kfal1: