SCOP 1.63: Domain d1j6tb_: 1j6t B:

Lineage for d1j6tb_ (1j6t B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)

7. Species Escherichia coli [TaxId:562] [55599] (12 PDB entries)

8. Domain d1j6tb_: 1j6t B: [77093]
   Other proteins in same PDB: d1j6ta_
   complexed with po3

Details for d1j6tb_

PDB Entry: 1j6t

PDB Description: complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d1j6tb_:

Sequence; same for both SEQRES and ATOM records:

>d1j6tb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d1j6tb_:

• d1j6tb_ is new in SCOP 1.63
  
• d1j6tb_ appears in SCOP 1.65
  
• d1j6tb_ appears in the current release, SCOPe 2.08