PDB entry 1j6t

View 1j6t on RCSB PDB site
Description: complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Deposited on 2002-08-14, released 2002-11-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-13, with a file datestamp of 2002-11-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1j6ta_
  • Chain 'B':
    Domains in SCOP 1.63: d1j6tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j6tA (A:)
lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
phgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
desvierlahttsvdevlellagr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j6tB (B:)
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele