SCOPe 2.07: Domain d1izlf_: 1izl F:

Lineage for d1izlf_ (1izl F:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.5: Photosystems [58155] (1 superfamily)

4. Superfamily i.5.1: Photosystems [58156] (1 family)

5. Family i.5.1.1: Photosystems [58157] (5 proteins)
   not a true family

6. Protein Photosystem II [58160] (2 species)
   there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains

7. Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)

8. Domain d1izlf_: 1izl F: [76999]
   complexed with bcr, cla, fe, hem, mn, pho, pla

Details for d1izlf_

PDB Entry: 1izl, 3.7 Å

PDB Description: crystal structure of photosystem ii

PDB Compounds: (F:) photosystem II: subunit psbf

SCOPe Domain Sequences for d1izlf_:

Sequence; same for both SEQRES and ATOM records:

>d1izlf_ i.5.1.1 (F:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
piftvrwvavhtlavptifflgaiaamqfi

Timeline for d1izlf_:

• d1izlf_ first appeared in SCOP 1.63
  
• d1izlf_ appears in SCOPe 2.06
  
• d1izlf_ appears in the current release, SCOPe 2.08