Lineage for d1izlf_ (1izl F:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 273239Fold i.5: Photosystems [58155] (1 superfamily)
  4. 273240Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 273241Family i.5.1.1: Photosystems [58157] (2 proteins)
    not a true family
  6. 273252Protein Photosystem II [58160] (2 species)
  7. 273290Species Thermosynechococcus vulcanus and Thermosynechococcus elongatus, bp-1 [82945] (1 PDB entry)
  8. 273298Domain d1izlf_: 1izl F: [76999]

Details for d1izlf_

PDB Entry: 1izl (more details), 3.7 Å

PDB Description: crystal structure of photosystem ii

SCOP Domain Sequences for d1izlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izlf_ i.5.1.1 (F:) Photosystem II {Thermosynechococcus vulcanus and Thermosynechococcus elongatus, bp-1}
piftvrwvavhtlavptifflgaiaamqfi

SCOP Domain Coordinates for d1izlf_:

Click to download the PDB-style file with coordinates for d1izlf_.
(The format of our PDB-style files is described here.)

Timeline for d1izlf_: