Lineage for d1izl0_ (1izl 0:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2648912Fold i.5: Photosystems [58155] (1 superfamily)
  4. 2648913Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 2648914Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 2648928Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 2648966Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 2648967Domain d1izl0_: 1izl 0: [76992]
    complexed with bcr, cla, fe, hem, mn, pho, pla

Details for d1izl0_

PDB Entry: 1izl (more details), 3.7 Å

PDB Description: crystal structure of photosystem ii
PDB Compounds: (0:) photosystem II: subunit psbv

SCOPe Domain Sequences for d1izl0_:

Sequence, based on SEQRES records: (download)

>d1izl0_ i.5.1.1 (0:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
eltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetlal
atpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilv
epki

Sequence, based on observed residues (ATOM records): (download)

>d1izl0_ i.5.1.1 (0:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
eltpevltvpltekqylegkrlfqyacaschvggitktnpsldlrtetlalatpprdnie
glvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilvepki

SCOPe Domain Coordinates for d1izl0_:

Click to download the PDB-style file with coordinates for d1izl0_.
(The format of our PDB-style files is described here.)

Timeline for d1izl0_: