Lineage for d1iyjd3 (1iyj D:2599-2731)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2398997Protein OB-fold domains of BRCA2 [82099] (2 species)
    duplication: tandem repeat of three OB-fold domains
  7. 2399005Species Norway rat (Rattus norvegicus) [TaxId:10116] [82101] (1 PDB entry)
  8. 2399009Domain d1iyjd3: 1iyj D:2599-2731 [76955]
    Other proteins in same PDB: d1iyjb1, d1iyjb2, d1iyjd1, d1iyjd2
    protein/DNA complex

Details for d1iyjd3

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (D:) breast cancer susceptibility

SCOPe Domain Sequences for d1iyjd3:

Sequence, based on SEQRES records: (download)

>d1iyjd3 b.40.4.3 (D:2599-2731) OB-fold domains of BRCA2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsalkkilerddtaaktlvlcvsdiislstnvsetsgskassedsnkvdtieltdgwyav
kaqldppllalvksgrltvgqkiitqgaelvgspdacapleapdslrlkisanstrparw
hsklgffhdprpf

Sequence, based on observed residues (ATOM records): (download)

>d1iyjd3 b.40.4.3 (D:2599-2731) OB-fold domains of BRCA2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsalkkilerddtaaktlvlcvsdiislskvdtieltdgwyavkaqldppllalvksgrl
tvgqkiitqgaelvgspdacapleapdslrlkisanstrparwhsklgffhdprpf

SCOPe Domain Coordinates for d1iyjd3:

Click to download the PDB-style file with coordinates for d1iyjd3.
(The format of our PDB-style files is described here.)

Timeline for d1iyjd3: