Lineage for d1iyjd2 (1iyj D:2761-2897)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348851Fold a.171: BRCA2 tower domain [81877] (1 superfamily)
    multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices
  4. 2348852Superfamily a.171.1: BRCA2 tower domain [81878] (1 family) (S)
  5. 2348853Family a.171.1.1: BRCA2 tower domain [81879] (1 protein)
  6. 2348854Protein BRCA2 tower domain [81880] (2 species)
  7. 2348858Species Norway rat (Rattus norvegicus) [TaxId:10116] [81882] (1 PDB entry)
  8. 2348860Domain d1iyjd2: 1iyj D:2761-2897 [76954]
    Other proteins in same PDB: d1iyjb1, d1iyjb3, d1iyjb4, d1iyjb5, d1iyjd1, d1iyjd3, d1iyjd4, d1iyjd5
    this domain is poorly ordered in the crystal structure
    protein/DNA complex

Details for d1iyjd2

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (D:) breast cancer susceptibility

SCOPe Domain Sequences for d1iyjd2:

Sequence, based on SEQRES records: (download)

>d1iyjd2 a.171.1.1 (D:2761-2897) BRCA2 tower domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vektvsgsyifrnereeekealrfaeaqqkklealftkvhtelkeheediaqrrvlsral
trqqvhalqdgaelyaavqdasdpehletcfseeqlralnnyrqmlsdkkqariqsefrk
aleaaekeeglsrdvst

Sequence, based on observed residues (ATOM records): (download)

>d1iyjd2 a.171.1.1 (D:2761-2897) BRCA2 tower domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vektvsgsyifrnereeekealrfsrdvst

SCOPe Domain Coordinates for d1iyjd2:

Click to download the PDB-style file with coordinates for d1iyjd2.
(The format of our PDB-style files is described here.)

Timeline for d1iyjd2: