Class j: Peptides [58231] (101 folds) |
Fold j.99: N-terminal fragment of gastric H/K-ATPase [82997] (1 superfamily) |
Superfamily j.99.1: N-terminal fragment of gastric H/K-ATPase [82998] (1 family) |
Family j.99.1.1: N-terminal fragment of gastric H/K-ATPase [82999] (1 protein) |
Protein N-terminal fragment of gastric H/K-ATPase [83000] (1 species) |
Species Synthetic, based on pig sequence [83001] (2 PDB entries) |
Domain d1iwca_: 1iwc A: [76872] TFE-induded structure |
PDB Entry: 1iwc (more details)
SCOP Domain Sequences for d1iwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwca_ j.99.1.1 (A:) N-terminal fragment of gastric H/K-ATPase {Synthetic, based on pig sequence} mgkaenyelyqvelgpgpsgdmaakmskkkagrg
Timeline for d1iwca_: