Lineage for d1iwca_ (1iwc A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047331Fold j.99: N-terminal fragment of gastric H/K-ATPase [82997] (1 superfamily)
  4. 3047332Superfamily j.99.1: N-terminal fragment of gastric H/K-ATPase [82998] (1 family) (S)
  5. 3047333Family j.99.1.1: N-terminal fragment of gastric H/K-ATPase [82999] (1 protein)
  6. 3047334Protein N-terminal fragment of gastric H/K-ATPase [83000] (1 species)
  7. 3047335Species Synthetic, based on pig sequence [83001] (2 PDB entries)
  8. 3047336Domain d1iwca_: 1iwc A: [76872]
    TFE-induced structure

Details for d1iwca_

PDB Entry: 1iwc (more details)

PDB Description: tfe-induded structure of the n-terminal domain of pig gastric h/k- atpase
PDB Compounds: (A:) gastric H/K-ATPase

SCOPe Domain Sequences for d1iwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwca_ j.99.1.1 (A:) N-terminal fragment of gastric H/K-ATPase {Synthetic, based on pig sequence}
mgkaenyelyqvelgpgpsgdmaakmskkkagrg

SCOPe Domain Coordinates for d1iwca_:

Click to download the PDB-style file with coordinates for d1iwca_.
(The format of our PDB-style files is described here.)

Timeline for d1iwca_: