| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (4 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (16 PDB entries) |
| Domain d1h24b2: 1h24 B:310-432 [76518] Other proteins in same PDB: d1h24a_, d1h24c_ |
PDB Entry: 1h24 (more details), 2.5 Å
SCOP Domain Sequences for d1h24b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h24b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl
Timeline for d1h24b2:
View in 3DDomains from other chains: (mouse over for more information) d1h24a_, d1h24c_, d1h24d1, d1h24d2 |